PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v1889390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 559aa    MW: 62869.2 Da    PI: 4.5148
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v1889390.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.82.2e-53201462128
              NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                      +pGfrFhPtdeel+++yLk+k+ gkkl++ ++i+e+d+yk++P+dLp +  +k+++k+w+fF++rd+ky++g r+nrat++gyWkatgkd++v+
  Lj5g3v1889390.1  20 MPGFRFHPTDEELIMYYLKRKICGKKLKF-HAIREIDVYKWDPEDLPgQsLLKTGDKQWFFFCHRDRKYPNGARSNRATTHGYWKATGKDRNVM 112
                      69**************************9.88**************9634778899************************************** PP

              NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + +++ vg+kktLvfy grap+ge+tdWvmhey+l
  Lj5g3v1889390.1 113 C-NSRSVGVKKTLVFYLGRAPSGERTDWVMHEYTL 146
                      *.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.76E-6015169IPR003441NAC domain
PROSITE profilePS5100554.32719169IPR003441NAC domain
PfamPF023652.8E-2721146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 559 aa     Download sequence    Send to blast
MGVDSEALSA DCFSQVMSSM PGFRFHPTDE ELIMYYLKRK ICGKKLKFHA IREIDVYKWD  60
PEDLPGQSLL KTGDKQWFFF CHRDRKYPNG ARSNRATTHG YWKATGKDRN VMCNSRSVGV  120
KKTLVFYLGR APSGERTDWV MHEYTLDEEE LKRCQGVKDY YALYKVFKKS GAGPKNGEQY  180
GAPFKEEEWA DDEPVDFNVV AAVQVAPNNV TDTVSDLMQP LCDGEIDEII RGILDDELVP  240
DQKHVNGLNF TQVVAEETQS TVAFQFSEAV MFPEPSENLH SSSQHYDVQP SFDFNQSVTS  300
HLHVSEAPEI TSAPNIQRED ELLFQENDFL EINDLADTEP TLANMENHVE NLQFEDGLSE  360
LDLFQDAEMF LRDLGPITHD TVSHSYMNTV DSNIDSQNYQ LLTNQAVDEL WMHDVRNILS  420
SEEGYDAGSN SLPTPGVVCE SVNYPPEGNE NQSSSTVEDI PMTPSRFSSA LWAFVESIPT  480
TPASAAENAL VNRALNRMSS FSRVRIKNTS IAAGKDTATK KRAGMRGISF LFFPIIVALC  540
AFLWVSLGNL RVLGRCISP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-482114617140Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.24350.0cell culture| pod| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001274375.10.0uncharacterized protein LOC100794925
TrEMBLI1LDA80.0I1LDA8_SOYBN; NAC transcription factor
STRINGGLYMA10G36360.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61313451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-141NAC domain containing protein 17